Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 9 (FGF9), Active Protein

Recombinant Human Fibroblast growth factor 9 (FGF9), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 9 (FGF9) . Accession Number: P31371; FGF9. Expression Region: 1-208aa. Tag Info: Tag-Free. Theoretical MW: 23.44kda. Target Synonyms: Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 9 (FGF9), Active Protein is a purified Active Recombinant Protein.

Accession Number

P31371; FGF9

Expression Region

1-208aa

Host

E. coli

Target

Fibroblast growth factor 9 (FGF9)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.44kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Fibroblast Growth Factor 9; FGF-9; Glia-Activating Factor; GAF; Heparin-Binding Growth Factor 9; HBGF-9; FGF9

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tetraethylammonium Tetrafluoroborate
IL-0348-HP-0025 25 g

Tetraethylammonium Tetrafluoroborate

Sign In for Pricing
View Details
Recombinant Human Leucine-rich repeat transmembrane protein FLRT2 (FLRT2), partial
MBS7054842 Inquire

Recombinant Human Leucine-rich repeat transmembrane protein FLRT2 (FLRT2), partial

Sign In for Pricing
View Details
TLX3 (G-8) AC
sc-514691 AC 500 µg/mL - 25% ag

TLX3 (G-8) AC

Sign In for Pricing
View Details
Leucine-rich repeat transmembrane protein FLRT3 (FLRT3) Rat ELISA Kit
E6473 96 Tests

Leucine-rich repeat transmembrane protein FLRT3 (FLRT3) Rat ELISA Kit

Sign In for Pricing
View Details
Rat Heparan sulfate 6 O sulfotransferase 3 (HS6ST3) ELISA kit
GTR10431405 96 Well

Rat Heparan sulfate 6 O sulfotransferase 3 (HS6ST3) ELISA kit

Sign In for Pricing
View Details
Potassium Iodide
28625-12 25 g

Potassium Iodide

Sign In for Pricing
View Details