Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor I (IGF1), partial , Active Protein

Recombinant Human Insulin-like growth factor I (IGF1), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <0.5 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Insulin-like growth factor I (IGF1) . Accession Number: P05019; IGF1. Expression Region: 52-118aa. Tag Info: Tag-Free. Theoretical MW: 7.3kda. Target Synonyms: Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Insulin-like growth factor I (IGF1), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P05019; IGF1

Expression Region

52-118aa

Host

E. coli

Target

Insulin-like growth factor I (IGF1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Signal Transduction

Endotoxin

<0.5 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2167246-01 0.1 mL

Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2167246-02 0.2 mL

Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2167246-03 0.5 mL

Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2167246-04 1 mL

Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2167246-05 5 mL

Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details
Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)
MBS2167246-06 5x 5 mL

Biotin-Linked Monoclonal Antibody to Procollagen III N-Terminal Propeptide (PIIINP)

Sign In for Pricing
View Details