Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2), Active Protein

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Granulocyte-macrophage colony-stimulating factor (Csf2) . Accession Number: P01587; Csf2. Expression Region: 18-141aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 15.1kda. Target Synonyms: Granulocyte-Macrophage Colony-Stimulating Factor; GM-CSF; Colony-Stimulating Factor; CSF; Molgramostin; Sargramostim; CSF2; GMCSF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Granulocyte-macrophage colony-stimulating factor (Csf2), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01587; Csf2

Expression Region

18-141aa

Host

Mammalian Cells

Target

Granulocyte-macrophage colony-stimulating factor (Csf2)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Granulocyte-Macrophage Colony-Stimulating Factor; GM-CSF; Colony-Stimulating Factor; CSF; Molgramostin; Sargramostim; CSF2; GMCSF

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPGQK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wilms Tumor Protein (WT1) (NM_001198551) Human Tagged ORF Clone
RC230799 10 µg

Wilms Tumor Protein (WT1) (NM_001198551) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-pig Vascular endothelial growth factor A polyclonal Antibody, HRP conjugated
MBS1490064-01 0.05 mg

Rabbit anti-pig Vascular endothelial growth factor A polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-pig Vascular endothelial growth factor A polyclonal Antibody, HRP conjugated
MBS1490064-02 0.1 mg

Rabbit anti-pig Vascular endothelial growth factor A polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-pig Vascular endothelial growth factor A polyclonal Antibody, HRP conjugated
MBS1490064-03 5x 0.1 mg

Rabbit anti-pig Vascular endothelial growth factor A polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
TIMP3 Rabbit Polyclonal Antibody
AF8169 50 µL

TIMP3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Trpm2 3'UTR Luciferase Stable Cell Line
TU121187 1.0 mL

Trpm2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details