Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial , Active Protein

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA) . Accession Number: P15509; CSF2RA. Expression Region: 23-320aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 35.5kda. Target Synonyms: Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P15509; CSF2RA

Expression Region

23-320aa

Host

Mammalian Cells

Target

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF136 sgRNA CRISPR Lentivector (Human) (Target 3)
K2688104 1.0 µg DNA

ZNF136 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant E.coli nrdA Protein, His-SUMO, E.coli-500ug
QP7262-ec-500ug 500ug

Recombinant E.coli nrdA Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
EphA3 Rabbit Polyclonal Antibody
APRab10519-01 20 µL

EphA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EphA3 Rabbit Polyclonal Antibody
APRab10519-02 50 µL

EphA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EphA3 Rabbit Polyclonal Antibody
APRab10519-03 100 µL

EphA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EphA3 Rabbit Polyclonal Antibody
APRab10519-04 200 µL

EphA3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details