Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial , Active Protein

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: Mammalian cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA) . Accession Number: P15509; CSF2RA. Expression Region: 23-320aa. Tag Info: C-terminal 6xHis-tagged. Theoretical MW: 35.5kda. Target Synonyms: Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P15509; CSF2RA

Expression Region

23-320aa

Host

Mammalian Cells

Target

Granulocyte-macrophage colony-stimulating factor receptor subunit alpha (CSF2RA)

Conjugation

Unconjugated

Tag

C-Terminal 6xHis-Tagged

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

35.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Granulocyte-Macrophage Colony-Stimulating Factor Receptor Subunit Alpha; GM-CSF-R-Alpha; GMCSFR-Alpha; GMR-Alpha; CDw116; CD116; CSF2RA; CSF2R; CSF2RY

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKCFLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHVNTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNCTWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGTHVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQYQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRAKHSVKIRAADVRILNWSSWSEAIEFGSDDG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SWI5 (NM_001040011) Human Tagged ORF Clone
RC211457 10 µg

SWI5 (NM_001040011) Human Tagged ORF Clone

Sign In for Pricing
View Details
SH3YL1 (NM_015677) Human Tagged Lenti ORF Clone
RC229166L3 10 µg

SH3YL1 (NM_015677) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Elmod2 3'UTR Luciferase Stable Cell Line
TU105770 1.0 mL

Elmod2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Cdkn2c Rat shRNA Lentiviral Particle (Locus ID 54238)
TL712568V 500 µL Each

Cdkn2c Rat shRNA Lentiviral Particle (Locus ID 54238)

Sign In for Pricing
View Details
Fibrin Degradation Product, D-Dimer (AP) discontinued
F4197-17B-AP 100 µL

Fibrin Degradation Product, D-Dimer (AP) discontinued

Sign In for Pricing
View Details
4- (4-Chlorobenzyl) phthalazin-1 (2H) -one
MF-0058149-01 10 mg

4- (4-Chlorobenzyl) phthalazin-1 (2H) -one

Sign In for Pricing
View Details