Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SPARC protein (SPARC), partial , Active Protein

Recombinant Human SPARC protein (SPARC), partial , Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: SPARC protein (SPARC) . Accession Number: P09486; SPARC; ON. Expression Region: 18-303aa. Tag Info: Tag-Free. Theoretical MW: 32.7kda. Target Synonyms: Basement-membrane protein 40; Osteonectin; ON; Secreted protein acidic and rich in cysteine Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human SPARC protein (SPARC), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P09486; SPARC; ON

Expression Region

18-303aa

Host

E. coli

Target

SPARC protein (SPARC)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

32.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Basement-membrane protein 40; Osteonectin; ON; Secreted protein acidic and rich in cysteine

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLT8D3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0869107 1.0 µg DNA

GLT8D3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human NrCAM MAb (Clone 297906)
MAB2034 100 µg

Human NrCAM MAb (Clone 297906)

Sign In for Pricing
View Details
Sec14l1 (NM_028777) Mouse Tagged Lenti ORF Clone
MR215236L3 10 µg

Sec14l1 (NM_028777) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Duck Oncoprotein Induced Transcript 3 ELISA Kit
MBS074069 Inquire

Duck Oncoprotein Induced Transcript 3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Phosphoadenosine phosphosulfate reductase (cysH)
MBS1460074-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis Phosphoadenosine phosphosulfate reductase (cysH)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis Phosphoadenosine phosphosulfate reductase (cysH)
MBS1460074-02 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis Phosphoadenosine phosphosulfate reductase (cysH)

Sign In for Pricing
View Details