Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human herpesvirus 8 type P protein (VMI2), partial , Active Protein

Recombinant Human herpesvirus 8 type P protein (VMI2), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus) . Target Name: herpesvirus 8 type P protein (VMI2) . Accession Number: Q98157; ORF K4. Expression Region: 24-93aa. Tag Info: Tag-Free. Theoretical MW: 8.0kda. Target Synonyms: Viral macrophage inflammatory protein II; vMIP-II vMIP-1B Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human herpesvirus 8 type P protein (VMI2), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q98157; ORF K4

Expression Region

24-93aa

Host

E. coli

Target

Herpesvirus 8 type P protein (VMI2)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Viral macrophage inflammatory protein II; vMIP-II vMIP-1B

Species

Human herpesvirus 8 type P (isolate GK18) (HHV-8) (Kaposi's sarcoma-associated herpesvirus)

Protein Name

Active Recombinant Protein

AA Sequence

LGASWHRPDKCCLGYQKRPLPQVLLSSWYPTSQLCSKPGVIFLTKRGRQVCADKSKDWVKKLMQQLPVTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cdpf1 Pre-designed siRNA Set B
SI102300B 1 Each

Mouse Cdpf1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Dehydrodolichyl Diphosphate Synthase (DHDDS) (NM_205861) Human Tagged ORF Clone Lentiviral Particle
RC214239L3V 200 µL

Dehydrodolichyl Diphosphate Synthase (DHDDS) (NM_205861) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)
MBS1341364-01 0.02 mg (E-Coli)

Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)
MBS1341364-02 0.02 mg (Yeast)

Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)
MBS1341364-03 0.1 mg (E-Coli)

Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)

Sign In for Pricing
View Details
Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)
MBS1341364-04 0.1 mg (Yeast)

Recombinant Streptomyces coelicolor Ketol-acid reductoisomerase 2 (ilvC2)

Sign In for Pricing
View Details