Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon lambda-1 protein (IFNL1), Active Protein

Recombinant Human Interferon lambda-1 protein (IFNL1), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interferon lambda-1 protein (IFNL1) . Accession Number: Q8IU54; IFNL1; IL29; ZCYTO21. Expression Region: 20-200aa. Tag Info: Tag-Free. Theoretical MW: 19.8kda. Target Synonyms: IFN-lambda-1; Interleukin-29; IL-29 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interferon lambda-1 protein (IFNL1), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q8IU54; IFNL1; IL29; ZCYTO21

Expression Region

20-200aa

Host

E. coli

Target

Interferon lambda-1 protein (IFNL1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

19.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IFN-lambda-1; Interleukin-29; IL-29

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD140a Purified
MBS1800058-01 0.1 mg

Anti-Hu CD140a Purified

Sign In for Pricing
View Details
Anti-Hu CD140a Purified
MBS1800058-02 5x 0.1 mg

Anti-Hu CD140a Purified

Sign In for Pricing
View Details
GNG5 Polyclonal Antibody, APC-Cy7 Conjugated
bs-13469R-APC-Cy7 100 µL

GNG5 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
MICB Protein, Human, Recombinant (C-His-Avi), Biotinylated
E51P01449 100 µg

MICB Protein, Human, Recombinant (C-His-Avi), Biotinylated

Sign In for Pricing
View Details
Cyclin G Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-1389R-BF680 100 µL

Cyclin G Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal SLMAP Antibody
NBP3-06131-100ul 100 µL

Rabbit Polyclonal SLMAP Antibody

Sign In for Pricing
View Details