Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 6 protein (FAS), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 6 protein (FAS), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 6 protein (FAS) . Accession Number: P25445; FAS; APT1; FAS1; TNFRSF6. Expression Region: 17-173aa. Tag Info: Tag-Free. Theoretical MW: 17.6kda. Target Synonyms: Apo-1 antigen; FASLG receptor; CD antigen CD95 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 6 protein (FAS), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P25445; FAS; APT1; FAS1; TNFRSF6

Expression Region

17-173aa

Host

E. coli

Target

Tumor necrosis factor receptor superfamily member 6 protein (FAS)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Apo-1 antigen; FASLG receptor; CD antigen CD95

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

RLSSKSVNAQVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CSN1S1 Rabbit mAb
E38MA4425 100 µL

Recombinant CSN1S1 Rabbit mAb

Sign In for Pricing
View Details
Troponin T, Fast Skeletal Muscle Isoforms (TNNT3) (TNNT3) Antibody
abx414868 250 µg

Troponin T, Fast Skeletal Muscle Isoforms (TNNT3) (TNNT3) Antibody

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)
MBS1063349-01 0.02 mg (E-Coli)

Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)
MBS1063349-02 0.02 mg (Yeast)

Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)
MBS1063349-03 0.1 mg (E-Coli)

Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details
Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)
MBS1063349-04 0.1 mg (Yeast)

Recombinant Burkholderia mallei Dihydrodipicolinate reductase (dapB)

Sign In for Pricing
View Details