Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9) . Accession Number: Q07011; TNFRSF9; CD137; ILA. Expression Region: 19-184aa. Tag Info: Tag-Free. Theoretical MW: 17.7kda. Target Synonyms: 4-1BB ligand receptor; T-cell antigen 4-1BB homolog; T-cell antigen ILA; CD antigen CD137 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9; CD137; ILA

Expression Region

19-184aa

Host

E. coli

Target

Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4-1BB ligand receptor; T-cell antigen 4-1BB homolog; T-cell antigen ILA; CD antigen CD137

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iqcf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6605107 1.0 µg DNA

Iqcf3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Repaglinide (Prandin, 2-Ethoxy-4-[2-[[ (1S) -3-methyl-1-[2- (1-piperidinyl) butyl]amino]-2-oxoethyl]-benzoic Acid, AG-EE-623, Novonorm, )
R1504 100 mg

Repaglinide (Prandin, 2-Ethoxy-4-[2-[[ (1S) -3-methyl-1-[2- (1-piperidinyl) butyl]amino]-2-oxoethyl]-benzoic Acid, AG-EE-623, Novonorm, )

Sign In for Pricing
View Details
DDX19B (NM_001014451) Human Tagged ORF Clone
RC224541 10 µg

DDX19B (NM_001014451) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human FCGR3A Protein, His, Insect-1mg
QP11860-HIS-INSECT-1mg 1mg

Recombinant Human FCGR3A Protein, His, Insect-1mg

Sign In for Pricing
View Details
Cesium chloride p.A.
LC-11590.1 500 g

Cesium chloride p.A.

Sign In for Pricing
View Details
Porcine Interleukin 25 ELISA Kit
MBS094713-01 48 Well

Porcine Interleukin 25 ELISA Kit

Sign In for Pricing
View Details