Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9) . Accession Number: Q07011; TNFRSF9; CD137; ILA. Expression Region: 19-184aa. Tag Info: Tag-Free. Theoretical MW: 17.7kda. Target Synonyms: 4-1BB ligand receptor; T-cell antigen 4-1BB homolog; T-cell antigen ILA; CD antigen CD137 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9; CD137; ILA

Expression Region

19-184aa

Host

E. coli

Target

Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4-1BB ligand receptor; T-cell antigen 4-1BB homolog; T-cell antigen ILA; CD antigen CD137

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBLOH Polyclonal Antibody
UB-GEN-7054 100 µL

DBLOH Polyclonal Antibody

Sign In for Pricing
View Details
IL18RAP, NT (CD218b, CDw218b, CD218 Antigen-like Family Member B, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, Accessory Protein-like, AcPL, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-18 Receptor beta, IL-18R-beta, IL-18Rbeta, Interleukin-18 Receptor Accessory Protein-like, Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, IL1R7) (AP) discontinued
I8440-03R-AP 200 µL

IL18RAP, NT (CD218b, CDw218b, CD218 Antigen-like Family Member B, Interleukin-1 Receptor 7, IL-1R-7, IL-1R7, Accessory Protein-like, AcPL, IL-1R Accessory Protein-like, IL-1RAcPL, Interleukin-18 Receptor beta, IL-18R-beta, IL-18Rbeta, Interleukin-18 Receptor Accessory Protein-like, Interleukin-18 Receptor Accessory Protein, IL-18 Receptor Accessory Protein, IL-18RAcP, IL1R7) (AP) discontinued

Sign In for Pricing
View Details
LOC498971 (NM_001047936) Rat Tagged Lenti ORF Clone
RR205634L4 10 µg

LOC498971 (NM_001047936) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
F Antibody
MBS7161939 Inquire

F Antibody

Sign In for Pricing
View Details
μ-TRTX-Hd1a
HY-P5790 1 Each

μ-TRTX-Hd1a

Sign In for Pricing
View Details
LRC26 rabbit pAb
MBS8600408-01 0.1 mL

LRC26 rabbit pAb

Sign In for Pricing
View Details