Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9) . Accession Number: Q07011; TNFRSF9; CD137; ILA. Expression Region: 19-184aa. Tag Info: Tag-Free. Theoretical MW: 17.7kda. Target Synonyms: 4-1BB ligand receptor; T-cell antigen 4-1BB homolog; T-cell antigen ILA; CD antigen CD137 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q07011; TNFRSF9; CD137; ILA

Expression Region

19-184aa

Host

E. coli

Target

Tumor necrosis factor receptor superfamily member 9 protein (TNFRSF9)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

4-1BB ligand receptor; T-cell antigen 4-1BB homolog; T-cell antigen ILA; CD antigen CD137

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

ERTRSLQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (MaxLight 550)
245804-ML550 100 µL

ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant IAV H9N2 Hemagglutinin / HA Protein (aa 1-523) [His] (A/Guinea fowl/Hong Kong/WF10/99) (Baculovirus-Insect Cells)
VAng-Wyb7083-50g 50 µg

Recombinant IAV H9N2 Hemagglutinin / HA Protein (aa 1-523) [His] (A/Guinea fowl/Hong Kong/WF10/99) (Baculovirus-Insect Cells)

Sign In for Pricing
View Details
Goat Polyclonal Goat anti-Mouse IgE Secondary Antibody [FITC]
NB7532 1 mL

Goat Polyclonal Goat anti-Mouse IgE Secondary Antibody [FITC]

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2091470-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2091470-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Interleukin 1 Alpha (IL1a)
MBS2091470-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Interleukin 1 Alpha (IL1a)

Sign In for Pricing
View Details