Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Pleiotrophin protein (PTN), Active Protein

Recombinant Human Pleiotrophin protein (PTN), Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Pleiotrophin protein (PTN) . Accession Number: P21246; PTN; HBNF1; NEGF1. Expression Region: 33-168aa. Tag Info: Tag-Free. Theoretical MW: 15.3kda. Target Synonyms: PTN; HBBM; Heparin-binding growth factor 8; HBGF-8; Heparin-binding growth-associated molecule Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Pleiotrophin protein (PTN), Active Protein is a purified Active Recombinant Protein.

Accession Number

P21246; PTN; HBNF1; NEGF1

Expression Region

33-168aa

Host

E. coli

Target

Pleiotrophin protein (PTN)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

15.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

PTN; HBBM; Heparin-binding growth factor 8; HBGF-8; Heparin-binding growth-associated molecule

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITM2C Polyclonal Conjugated Antibody
orb1628465 100 µL

ITM2C Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
VN2R1P discontinued
346486-01 100 µL

VN2R1P discontinued

Sign In for Pricing
View Details
VN2R1P discontinued
346486-02 200 µL

VN2R1P discontinued

Sign In for Pricing
View Details
Recombinant Escherichia coli Lipid A palmitoyltransferase PagP (pagP)
MBS1243940-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Lipid A palmitoyltransferase PagP (pagP)

Sign In for Pricing
View Details
Recombinant Escherichia coli Lipid A palmitoyltransferase PagP (pagP)
MBS1243940-02 0.1 mg (E-Coli)

Recombinant Escherichia coli Lipid A palmitoyltransferase PagP (pagP)

Sign In for Pricing
View Details
Recombinant Escherichia coli Lipid A palmitoyltransferase PagP (pagP)
MBS1243940-03 0.02 mg (Yeast)

Recombinant Escherichia coli Lipid A palmitoyltransferase PagP (pagP)

Sign In for Pricing
View Details