Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 17 protein (FGF17), Active Protein

Recombinant Human Fibroblast growth factor 17 protein (FGF17), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 17 protein (FGF17) . Accession Number: O60258; FGF17; UNQ161/PRO187. Expression Region: 23-216aa. Tag Info: Tag-Free. Theoretical MW: 22.6kda. Target Synonyms: FGF-17 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 17 protein (FGF17), Active Protein is a purified Active Recombinant Protein.

Accession Number

O60258; FGF17; UNQ161/PRO187

Expression Region

23-216aa

Host

E. coli

Target

Fibroblast growth factor 17 protein (FGF17)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

22.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-17

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

M+TQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFVGSAPTRRTKRTRRPQPLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Troponin I Type 3, Cardiac (TNNI3) ELISA Kit
RDR-TNNI3-Ra-01 96 Tests

Rat Troponin I Type 3, Cardiac (TNNI3) ELISA Kit

Sign In for Pricing
View Details
Rat Troponin I Type 3, Cardiac (TNNI3) ELISA Kit
RDR-TNNI3-Ra-02 48 Tests

Rat Troponin I Type 3, Cardiac (TNNI3) ELISA Kit

Sign In for Pricing
View Details
Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody
TA364867 100 µL

Kallikrein 6 (KLK6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF568 conjugate, 0.1mg/mL
BNC681994-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (MMP3/1994R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nedd8 (NM_008683) Mouse Tagged ORF Clone
MG200148 10 µg

Nedd8 (NM_008683) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
c-Myc (MYC) pThr358 Rabbit Polyclonal Antibody
AP02336PU-N 100 µL

c-Myc (MYC) pThr358 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details