Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 9 protein (FGF9), partial , Active Protein

Recombinant Human Fibroblast growth factor 9 protein (FGF9), partial , Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 9 protein (FGF9) . Accession Number: P31371; FGF9. Expression Region: 2-208aa. Tag Info: Tag-Free. Theoretical MW: 23.3kda. Target Synonyms: FGF-9; GAF; Heparin-binding growth factor 9; HBGF-9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 9 protein (FGF9), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P31371; FGF9

Expression Region

2-208aa

Host

E. coli

Target

Fibroblast growth factor 9 protein (FGF9)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

23.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-9; GAF; Heparin-binding growth factor 9; HBGF-9

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hnmt shRNA (UAS) - Lentiviral mouse Hnmt shRNA (UAS, GFP) (100)
GTR15212973 1 Vial

Lentiviral mouse Hnmt shRNA (UAS) - Lentiviral mouse Hnmt shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)
MBS1405855-01 0.02 mg (E-Coli)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)
MBS1405855-02 0.1 mg (E-Coli)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)
MBS1405855-03 0.02 mg (Yeast)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)
MBS1405855-04 0.1 mg (Yeast)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)

Sign In for Pricing
View Details
Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)
MBS1405855-05 0.02 mg (Baculovirus)

Recombinant Lactobacillus delbrueckii subsp. bulgaricus Cell division protein SepF (sepF)

Sign In for Pricing
View Details