Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 7 protein (FGF7), Active Protein

Recombinant Human Fibroblast growth factor 7 protein (FGF7), Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 7 protein (FGF7) . Accession Number: P21781; FGF7; KGF. Expression Region: 32-194aa. Tag Info: Tag-Free. Theoretical MW: 18.9kda. Target Synonyms: FGF-7; HBGF-7; Keratinocyte growth factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 7 protein (FGF7), Active Protein is a purified Active Recombinant Protein.

Accession Number

P21781; FGF7; KGF

Expression Region

32-194aa

Host

E. coli

Target

Fibroblast growth factor 7 protein (FGF7)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-7; HBGF-7; Keratinocyte growth factor

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRNA turnover protein 4 homolog (MRTO4) Mouse ELISA Kit
F1044 96 Tests

MRNA turnover protein 4 homolog (MRTO4) Mouse ELISA Kit

Sign In for Pricing
View Details
ECHDC1 (NM_018479) Human Tagged Lenti ORF Clone
RC219950L3 10 µg

ECHDC1 (NM_018479) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Ashbya gossypii Probable nucleolar complex protein 14 (NOP14), partial
MBS1455766 Inquire

Recombinant Ashbya gossypii Probable nucleolar complex protein 14 (NOP14), partial

Sign In for Pricing
View Details
PPIG (NM_004792) Human Tagged ORF Clone
RC224587 10 µg

PPIG (NM_004792) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human ACE2 His and DYKDDDDK Tag
MBS669487-01 0.05 mg

Recombinant Human ACE2 His and DYKDDDDK Tag

Sign In for Pricing
View Details
Recombinant Human ACE2 His and DYKDDDDK Tag
MBS669487-02 0.1 mg

Recombinant Human ACE2 His and DYKDDDDK Tag

Sign In for Pricing
View Details