Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 7 protein (FGF7), Active Protein

Recombinant Human Fibroblast growth factor 7 protein (FGF7), Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Fibroblast growth factor 7 protein (FGF7) . Accession Number: P21781; FGF7; KGF. Expression Region: 32-194aa. Tag Info: Tag-Free. Theoretical MW: 18.9kda. Target Synonyms: FGF-7; HBGF-7; Keratinocyte growth factor Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Fibroblast growth factor 7 protein (FGF7), Active Protein is a purified Active Recombinant Protein.

Accession Number

P21781; FGF7; KGF

Expression Region

32-194aa

Host

E. coli

Target

Fibroblast growth factor 7 protein (FGF7)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Cancer

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

18.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FGF-7; HBGF-7; Keratinocyte growth factor

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anks4b (NM_001127650) Rat Tagged ORF Clone Lentiviral Particle
RR213593L3V 200 µL

Anks4b (NM_001127650) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
EAUDECLIM.355X37RL-T1-LL-P16 Pipe Markers for Water
N001590 30 Pack (30 Marker (s) x 1 Roll)

EAUDECLIM.355X37RL-T1-LL-P16 Pipe Markers for Water

Sign In for Pricing
View Details
IMP3 Antibody - N-terminal region : FITC (ARP74590_P050-FITC)
ARP74590_P050-FITC 100 µL

IMP3 Antibody - N-terminal region : FITC (ARP74590_P050-FITC)

Sign In for Pricing
View Details
Zc3h3 3'UTR Luciferase Stable Cell Line
TU122512 1.0 mL

Zc3h3 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
genesig Std Real-time PCR detection kit for PCV1
Z-Path-PCV1-std 150 Tests

genesig Std Real-time PCR detection kit for PCV1

Sign In for Pricing
View Details
Dux (NM_001081954) Mouse Untagged Clone
MC220398 10 µg

Dux (NM_001081954) Mouse Untagged Clone

Sign In for Pricing
View Details