Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-8 protein (CXCL8), partial , Active Protein

Recombinant Human Interleukin-8 protein (CXCL8), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-8 protein (CXCL8) . Accession Number: P10145; CXCL8; IL8. Expression Region: 28-99aa. Tag Info: Tag-Free. Theoretical MW: 8.4kda. Target Synonyms: IL-8; Chemokine C-X-C motif; ligand 8; Emoctakin; Granulocyte chemotactic protein 1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-8 protein (CXCL8), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P10145; CXCL8; IL8

Expression Region

28-99aa

Host

E. coli

Target

Interleukin-8 protein (CXCL8)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-8; Chemokine C-X-C motif; ligand 8; Emoctakin; Granulocyte chemotactic protein 1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 490)
MBS6338629-01 0.1 mL

PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 490)

Sign In for Pricing
View Details
PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 490)
MBS6338629-02 5x 0.1 mL

PTEN, Phosphorylated (Y240) (PTEN, MMAC1, TEP1, Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN, Mutated in multiple advanced cancers 1, Phosphatase and tensin homolog) (MaxLight 490)

Sign In for Pricing
View Details
C10orf84 (FAM204A) (NM_022063) Human Over-expression Lysate
E45H11607-2 20 µg

C10orf84 (FAM204A) (NM_022063) Human Over-expression Lysate

Sign In for Pricing
View Details
mmu-miR-6239 miRNA Inhibitor
MIM02332 2x 5.0 nmol

mmu-miR-6239 miRNA Inhibitor

Sign In for Pricing
View Details
Anti-Mouse LYZ1 Polyclonal Antibody
MP653014-01 50 µg

Anti-Mouse LYZ1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse LYZ1 Polyclonal Antibody
MP653014-02 100 µg

Anti-Mouse LYZ1 Polyclonal Antibody

Sign In for Pricing
View Details