Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine protein (Ccl28), Active Protein

Recombinant Rat C-C motif chemokine protein (Ccl28), Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine protein (Ccl28) . Accession Number: Q91Y39; Ccl28. Expression Region: 20-135aa. Tag Info: Tag-Free. Theoretical MW: 13.1kda Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine protein (Ccl28), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q91Y39; Ccl28

Expression Region

20-135aa

Host

E. coli

Target

C-C motif chemokine protein (Ccl28)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

13.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

SEAILPIASSCCTEVSHHIPRRLLERVNSCSIQRADGDCDLAAVILHVKRRRICVSPHNPTLKRWMSASEMKNGKENLCPRKKQDSGKDRKGHTPRKHGKHGTRRIHGTHDHEAPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Collagen V alpha 3 Antibody [Alexa Fluor 405]
NBP3-05942AF405 0.1 mL

Rabbit Polyclonal Collagen V alpha 3 Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details
Caspase 3 (CASP3) Rabbit Monoclonal Antibody [Clone ID: RM250]
TA398461 100 µL

Caspase 3 (CASP3) Rabbit Monoclonal Antibody [Clone ID: RM250]

Sign In for Pricing
View Details
Med15 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6130502 1.0 µg DNA

Med15 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Fibronectin (FN) BioAssayTM ELISA Kit (Rabbit)
589279 96 Tests

Fibronectin (FN) BioAssayTM ELISA Kit (Rabbit)

Sign In for Pricing
View Details
TMEM150C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV698204 1.0 µg DNA

TMEM150C Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Monkey YY1-Associated Factor 2 (YAF2) ELISA Kit
MBS9932297-01 48 Well

Monkey YY1-Associated Factor 2 (YAF2) ELISA Kit

Sign In for Pricing
View Details