Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-C motif chemokine 4 protein (Ccl4), Active Protein

Recombinant Rat C-C motif chemokine 4 protein (Ccl4), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-C motif chemokine 4 protein (Ccl4) . Accession Number: P50230; Ccl4; Mip1b; Scya4. Expression Region: 24-92aa. Tag Info: Tag-Free. Theoretical MW: 7.8kda. Target Synonyms: Macrophage inflammatory protein 1-beta; Small-inducible cytokine A4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-C motif chemokine 4 protein (Ccl4), Active Protein is a purified Active Recombinant Protein.

Accession Number

P50230; Ccl4; Mip1b; Scya4

Expression Region

24-92aa

Host

E. coli

Target

C-C motif chemokine 4 protein (Ccl4)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Macrophage inflammatory protein 1-beta; Small-inducible cytokine A4

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

APIGSDPPTSCCFSYTSRKIHRNFVMDYYETSSLCSQPAVVFLTKKGRQICADPSEPWVNEYVNDLELN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA™ Mouse Receptor Tyrosine Protein Kinase erbB-2 (ErbB2) ELISA
KLM2418 1x 96 Well

GENLISA™ Mouse Receptor Tyrosine Protein Kinase erbB-2 (ErbB2) ELISA

Sign In for Pricing
View Details
Rat Pnpla7 ELISA Kit
ELI-45341r 96 Tests

Rat Pnpla7 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal IL-36Ra/IL-1F5 Antibody (022) [PerCP]
NBP2-90483PCP 0.1 mL

Rabbit Monoclonal IL-36Ra/IL-1F5 Antibody (022) [PerCP]

Sign In for Pricing
View Details
Rabbit Polyclonal IFN-gamma R2 Antibody
NBP1-90223 0.1 mL

Rabbit Polyclonal IFN-gamma R2 Antibody

Sign In for Pricing
View Details
Recombinant Human CABP7
P6119-01 50 µg

Recombinant Human CABP7

Sign In for Pricing
View Details
Recombinant Human CABP7
P6119-02 200 µg

Recombinant Human CABP7

Sign In for Pricing
View Details