Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12), Active Protein

Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12) . Accession Number: Q9QZD1; Cxcl12. Expression Region: 22-89aa. Tag Info: Tag-Free. Theoretical MW: 8.4kda. Target Synonyms: SDF-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9QZD1; Cxcl12

Expression Region

22-89aa

Host

E. coli

Target

Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SDF-1

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK+RLKM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlamydia trachomatis MOMP Monoclonal Antibody
MBS190103-01 0.1 mg

Chlamydia trachomatis MOMP Monoclonal Antibody

Sign In for Pricing
View Details
Chlamydia trachomatis MOMP Monoclonal Antibody
MBS190103-02 0.5 mg

Chlamydia trachomatis MOMP Monoclonal Antibody

Sign In for Pricing
View Details
Chlamydia trachomatis MOMP Monoclonal Antibody
MBS190103-03 1 mg

Chlamydia trachomatis MOMP Monoclonal Antibody

Sign In for Pricing
View Details
Chlamydia trachomatis MOMP Monoclonal Antibody
MBS190103-04 5x 1 mg

Chlamydia trachomatis MOMP Monoclonal Antibody

Sign In for Pricing
View Details
Elf5 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3377704 1.0 µg DNA

Elf5 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Protocadherin Beta 15 (PCDHb15)
MBS2095640-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Protocadherin Beta 15 (PCDHb15)

Sign In for Pricing
View Details