Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12), Active Protein

Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12) . Accession Number: Q9QZD1; Cxcl12. Expression Region: 22-89aa. Tag Info: Tag-Free. Theoretical MW: 8.4kda. Target Synonyms: SDF-1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9QZD1; Cxcl12

Expression Region

22-89aa

Host

E. coli

Target

Chemokine (C-X-C motif) ligand 12 (Stromal cell-derived factor 1) protein (Cxcl12)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SDF-1

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKSNNRQVCIDPKLKWIQEYLDKALNK+RLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL
BNC880669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-100 1x 100 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF488A conjugate, 0.1mg/mL
BNC880333-100 1x 100 µL

CD8 (RIV11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-500 1x 500 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL
BNC741073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details