Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-X-C motif chemokine 10 protein (Cxcl10), Active Protein

Recombinant Rat C-X-C motif chemokine 10 protein (Cxcl10), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-X-C motif chemokine 10 protein (Cxcl10) . Accession Number: P48973; Cxcl10; Inp10; Mob1; Scyb10. Expression Region: 22-98aa. Tag Info: Tag-Free. Theoretical MW: 8.7kda. Target Synonyms: 10 kDa interferon gamma-induced protein; IP-10; Interferon-inducible protein 10; Protein Mob-1; Small-inducible cytokine B10 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-X-C motif chemokine 10 protein (Cxcl10), Active Protein is a purified Active Recombinant Protein.

Accession Number

P48973; Cxcl10; Inp10; Mob1; Scyb10

Expression Region

22-98aa

Host

E. coli

Target

C-X-C motif chemokine 10 protein (Cxcl10)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

10 kDa interferon gamma-induced protein; IP-10; Interferon-inducible protein 10; Protein Mob-1; Small-inducible cytokine B10

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-500 1x 500 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF405S conjugate, 0.1mg/mL
BNC040176-500 1x 500 µL

CD5 (Cris-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL
BNC740050-100 1x 100 µL

IgA Secretory Component (SC05), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details