Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-X-C motif chemokine 10 protein (Cxcl10), Active Protein

Recombinant Rat C-X-C motif chemokine 10 protein (Cxcl10), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-X-C motif chemokine 10 protein (Cxcl10) . Accession Number: P48973; Cxcl10; Inp10; Mob1; Scyb10. Expression Region: 22-98aa. Tag Info: Tag-Free. Theoretical MW: 8.7kda. Target Synonyms: 10 kDa interferon gamma-induced protein; IP-10; Interferon-inducible protein 10; Protein Mob-1; Small-inducible cytokine B10 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-X-C motif chemokine 10 protein (Cxcl10), Active Protein is a purified Active Recombinant Protein.

Accession Number

P48973; Cxcl10; Inp10; Mob1; Scyb10

Expression Region

22-98aa

Host

E. coli

Target

C-X-C motif chemokine 10 protein (Cxcl10)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

10 kDa interferon gamma-induced protein; IP-10; Interferon-inducible protein 10; Protein Mob-1; Small-inducible cytokine B10

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BD Rat t-stim with con a 10000 units
354115 1 Each

BD Rat t-stim with con a 10000 units

Sign In for Pricing
View Details
SNAP23, CT (SNAP23, Synaptosomal-associated protein 23, Vesicle-membrane fusion protein SNAP-23) (MaxLight 405) discontinued
042075-ML405 100 µL

SNAP23, CT (SNAP23, Synaptosomal-associated protein 23, Vesicle-membrane fusion protein SNAP-23) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Nudt3 (NM_001024243) Rat Tagged ORF Clone
RR214273 10 µg

Nudt3 (NM_001024243) Rat Tagged ORF Clone

Sign In for Pricing
View Details
PLAC8 shRNA Plasmid (m)
sc-76169-SH 20 µg

PLAC8 shRNA Plasmid (m)

Sign In for Pricing
View Details
Presto™ Endotoxin Free Mini Plasmid Kit
PEH004 each

Presto™ Endotoxin Free Mini Plasmid Kit

Sign In for Pricing
View Details
CCNG1 3'UTR GFP Stable Cell Line
TU053794 1.0 mL

CCNG1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details