Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat C-X-C motif chemokine 3 protein (Cxcl3), partial , Active Protein

Recombinant Rat C-X-C motif chemokine 3 protein (Cxcl3), partial , Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Rat (Rattus norvegicus) . Target Name: C-X-C motif chemokine 3 protein (Cxcl3) . Accession Number: Q10746; Cxcl3; Cinc2. Expression Region: 33-97aa+PSL. Tag Info: Tag-Free. Theoretical MW: 7.6kda. Target Synonyms: Cytokine-induced neutrophil chemoattractant 2; Macrophage inflammatory protein 2-alpha/beta; MIP2-alpha/beta Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Rat C-X-C motif chemokine 3 protein (Cxcl3), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q10746; Cxcl3; Cinc2

Expression Region

33-97aa+PSL

Host

E. coli

Target

C-X-C motif chemokine 3 protein (Cxcl3)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Cytokine-induced neutrophil chemoattractant 2; Macrophage inflammatory protein 2-alpha/beta; MIP2-alpha/beta

Species

Rat (Rattus norvegicus)

Protein Name

Active Recombinant Protein

AA Sequence

RELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSPSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-100 1x 100 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL
BNC400253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF568 conjugate, 0.1mg/mL
BNC681836-100 1x 100 µL

NKX2.2 (Neuroendocrine & Ewing s Sarcoma Marker) (rNX2/294), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF568 conjugate, 0.1mg/mL
BNC680484-100 1x 100 µL

Progesterone Receptor (PR484), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/144B), CF640R conjugate, 0.1mg/mL
BNC400749-100 1x 100 µL

CD8 (C8/144B), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details