Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 27 protein (Ccl27), partial , Active Protein

Recombinant Mouse C-C motif chemokine 27 protein (Ccl27), partial , Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-C motif chemokine 27 protein (Ccl27) . Accession Number: Q9Z1X0; Ccl27; Ilc; Scya27. Expression Region: 26-120aa. Tag Info: Tag-Free. Theoretical MW: 10.9kda. Target Synonyms: CC chemokine ILC; CTACK; ESkine; IL-11 R-alpha-locus chemokine; ALP Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-C motif chemokine 27 protein (Ccl27), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9Z1X0; Ccl27; Ilc; Scya27

Expression Region

26-120aa

Host

E. coli

Target

C-C motif chemokine 27 protein (Ccl27)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Partial of NM_011336

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

CC chemokine ILC; CTACK; ESkine; IL-11 R-alpha-locus chemokine; ALP

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

LPLPSSTSCCTQLYRQPLPSRLLRRIVHMELQEADGDCHLQAVVLHLARRSVCVHPQNRSLARWLERQGKRLQGTVPSLNLVLQKKMYSNPQQQN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
BNC040096-100 1x 100 µL

Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-100 1x 100 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL
BNC740096-500 1x 500 µL

Histone H1 (AE-4), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF488A conjugate, 0.1mg/mL
BNC882957-100 1x 100 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2957), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details