Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 25 protein (Ccl25), Active Protein

Recombinant Mouse C-C motif chemokine 25 protein (Ccl25), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-C motif chemokine 25 protein (Ccl25) . Accession Number: O35903; Ccl25; Scya25; Teck. Expression Region: 24-144aa. Tag Info: Tag-Free. Theoretical MW: 14.1kda. Target Synonyms: Chemokine TECK; Thymus-expressed chemokine Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-C motif chemokine 25 protein (Ccl25), Active Protein is a purified Active Recombinant Protein.

Accession Number

O35903; Ccl25; Scya25; Teck

Expression Region

24-144aa

Host

E. coli

Target

C-C motif chemokine 25 protein (Ccl25)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

14.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Chemokine TECK; Thymus-expressed chemokine

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

QGAFEDCCLGYQHRIKWNVLRHARNYHQQEVSGSCNLRAVRFYFRQKVVCGNPEDMNVKRAIRILTARKRLVHWKSASDSQTERKKSNHMKSKVENPNSTSVRSATLGHPRMVMMPRKTNN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-500 1x 500 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL
BNC880204-500 1x 500 µL

Complement C4d (C4D204), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL
BNC470525-500 1x 500 µL

CD63 (MX-49.129.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL
BNC700774-100 1x 100 µL

HSP27 (HSPB1/774), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF568 conjugate, 0.1mg/mL
BNC680735-500 1x 500 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details