Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 24 protein (Ccl24), Active Protein

Recombinant Mouse C-C motif chemokine 24 protein (Ccl24), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-C motif chemokine 24 protein (Ccl24) . Accession Number: Q9JKC0; Ccl24; Scya24. Expression Region: 27-119aa. Tag Info: Tag-Free. Theoretical MW: 10.3kda. Target Synonyms: Eosinophil chemotactic protein 2; Small-inducible cytokine A24 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-C motif chemokine 24 protein (Ccl24), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9JKC0; Ccl24; Scya24

Expression Region

27-119aa

Host

E. coli

Target

C-C motif chemokine 24 protein (Ccl24)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Eosinophil chemotactic protein 2; Small-inducible cytokine A24

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Keratin 12 ELISA Kit
ELA-E8860h 96 Tests

Human Keratin 12 ELISA Kit

Sign In for Pricing
View Details
Bovine Anti-Apolipoprotein Antibodies AAHA ELISA Kit
BG-BVN10109 1 Each

Bovine Anti-Apolipoprotein Antibodies AAHA ELISA Kit

Sign In for Pricing
View Details
Bod1 ORF Vector (Mouse) (pORF)
ORF039918 1.0 µg DNA

Bod1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Mini-Blender Chamber, 125-350ml
293350 1 Unit

Mini-Blender Chamber, 125-350ml

Sign In for Pricing
View Details
pLV2-U6-WWP2-shRNA2-PGK-Puro Plasmid
PVT46587 2 µg

pLV2-U6-WWP2-shRNA2-PGK-Puro Plasmid

Sign In for Pricing
View Details
Lpcat2b (NM_001025631) Rat Tagged ORF Clone Lentiviral Particle
RR206482L3V 200 µL

Lpcat2b (NM_001025631) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details