Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 22 protein (Ccl22)

Recombinant Mouse C-C motif chemokine 22 protein (Ccl22) is a purified Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-C motif chemokine 22 protein (Ccl22) . Accession Number: O88430; Ccl22; Abcd1; Scya22. Expression Region: 25-92aa. Tag Info: Tag-Free. Theoretical MW: 7.8kda. Target Synonyms: Activated B and dendritic cell-derived; Small-inducible cytokine A22 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-C motif chemokine 22 protein (Ccl22) is a purified Recombinant Protein.

Accession Number

O88430; Ccl22; Abcd1; Scya22

Expression Region

25-92aa

Host

E. coli

Target

C-C motif chemokine 22 protein (Ccl22)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Not Tested

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Activated B and dendritic cell-derived; Small-inducible cytokine A22

Species

Mouse (Mus musculus)

Protein Name

Recombinant Protein

AA Sequence

GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL
BNC680630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), 1mg/mL
BNUM0026-50 1x 50 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), 1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (139H2), CF488A conjugate, 0.1mg/mL
BNC880925-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (139H2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF740 conjugate, 0.1mg/mL
BNC742167-500 1x 500 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2167), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details