Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 21c protein (Ccl21c), Active Protein

Recombinant Mouse C-C motif chemokine 21c protein (Ccl21c), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-C motif chemokine 21c protein (Ccl21c) . Accession Number: P86793; Ccl21c; Scya21c. Expression Region: 24-133aa. Tag Info: Tag-Free. Theoretical MW: 12.1kda. Target Synonyms: 6Ckine; Small-inducible cytokine A21c; Thymus-derived chemotactic agent 4; TCA4 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-C motif chemokine 21c protein (Ccl21c), Active Protein is a purified Active Recombinant Protein.

Accession Number

P86793; Ccl21c; Scya21c

Expression Region

24-133aa

Host

E. coli

Target

C-C motif chemokine 21c protein (Ccl21c)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

6Ckine; Small-inducible cytokine A21c; Thymus-derived chemotactic agent 4; TCA4

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CFTR Antibody (rCFTR/8048) [DyLight 650]
NBP3-24054C 0.1 mL

Mouse Monoclonal CFTR Antibody (rCFTR/8048) [DyLight 650]

Sign In for Pricing
View Details
Chlorhexidine Digluconate (In 20% solution)
444341-01 25 mL

Chlorhexidine Digluconate (In 20% solution)

Sign In for Pricing
View Details
Chlorhexidine Digluconate (In 20% solution)
444341-02 100 mL

Chlorhexidine Digluconate (In 20% solution)

Sign In for Pricing
View Details
Chlorhexidine Digluconate (In 20% solution)
444341-03 250 mL

Chlorhexidine Digluconate (In 20% solution)

Sign In for Pricing
View Details
Chlorhexidine Digluconate (In 20% solution)
444341-04 1 L

Chlorhexidine Digluconate (In 20% solution)

Sign In for Pricing
View Details
Chlorhexidine Digluconate (In 20% solution)
444341-05 4 L

Chlorhexidine Digluconate (In 20% solution)

Sign In for Pricing
View Details