Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Eotaxin protein (Ccl11), Active Protein

Recombinant Mouse Eotaxin protein (Ccl11), Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Eotaxin protein (Ccl11) . Accession Number: P48298; Ccl11; Scya11. Expression Region: 24-97aa. Tag Info: Tag-Free. Theoretical MW: 8.4kda. Target Synonyms: C-C motif chemokine 11; Small-inducible cytokine A11 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Eotaxin protein (Ccl11), Active Protein is a purified Active Recombinant Protein.

Accession Number

P48298; Ccl11; Scya11

Expression Region

24-97aa

Host

E. coli

Target

Eotaxin protein (Ccl11)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C-C motif chemokine 11; Small-inducible cytokine A11

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAPDHP62 Protein Lysate (Human) with C-Ha Tag
21296031 100 µg

GAPDHP62 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Hiscreen Phenyl Ff Low Sub
28926989 1 Each

Hiscreen Phenyl Ff Low Sub

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)
MBS1337167-01 0.02 mg (E-Coli)

Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)
MBS1337167-02 0.02 mg (Yeast)

Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)
MBS1337167-03 0.1 mg (E-Coli)

Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)

Sign In for Pricing
View Details
Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)
MBS1337167-04 0.1 mg (Yeast)

Recombinant Staphylococcus haemolyticus UPF0176 protein SH0299 (SH0299)

Sign In for Pricing
View Details