Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C motif chemokine 16 protein (Cxcl16), partial , Active Protein

Recombinant Mouse C-X-C motif chemokine 16 protein (Cxcl16), partial , Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-X-C motif chemokine 16 protein (Cxcl16) . Accession Number: Q8BSU2; Cxcl16; Srpsox. Expression Region: 27-114aa. Tag Info: Tag-Free. Theoretical MW: 9.9kda. Target Synonyms: Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; Small-inducible cytokine B16; Transmembrane chemokine CXCL16 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-X-C motif chemokine 16 protein (Cxcl16), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q8BSU2; Cxcl16; Srpsox

Expression Region

27-114aa

Host

E. coli

Target

C-X-C motif chemokine 16 protein (Cxcl16)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

9.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein; Small-inducible cytokine B16; Transmembrane chemokine CXCL16

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

NQGSVAGSCSCDRTISSGTQIPQGTLDHIRKYLKAFHRCPFFIRFQLQSKSVCGGSQDQWVRELVDCFERKECGTGHGKSFHHQKHLP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMY1D HDR Plasmid (h)
sc-418561-HDR 20 µg

RBMY1D HDR Plasmid (h)

Sign In for Pricing
View Details
CD56 (NCAM, Leu-19, NKH1, MSK39, NCAM1, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (BSA & Azide Free) (MaxLight 550)
MBS6215304-01 0.1 mL

CD56 (NCAM, Leu-19, NKH1, MSK39, NCAM1, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
CD56 (NCAM, Leu-19, NKH1, MSK39, NCAM1, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (BSA & Azide Free) (MaxLight 550)
MBS6215304-02 5x 0.1 mL

CD56 (NCAM, Leu-19, NKH1, MSK39, NCAM1, NCAM120, NCAM140, NCAM180, Neural Cell Adhesion Molecule) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
CTP synthase (CTPS1) (NM_001905) Human Tagged ORF Clone Lentiviral Particle
RC202434L3V 200 µL

CTP synthase (CTPS1) (NM_001905) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sun3 Mouse shRNA Plasmid (Locus ID 194974)
TL506211 1 Kit

Sun3 Mouse shRNA Plasmid (Locus ID 194974)

Sign In for Pricing
View Details
Mouse Granzyme B (Gzms-B) ELISA Kit
JL11913-01 48 Tests

Mouse Granzyme B (Gzms-B) ELISA Kit

Sign In for Pricing
View Details