Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C motif chemokine 14 protein (Cxcl14), Active Protein

Recombinant Mouse C-X-C motif chemokine 14 protein (Cxcl14), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-X-C motif chemokine 14 protein (Cxcl14) . Accession Number: Q9WUQ5; Cxcl14; Bmac; Kec; Ks1; Mip2g; Scyb14. Expression Region: 23-99aa. Tag Info: Tag-Free. Theoretical MW: 9.4kda. Target Synonyms: B-cell and monocyte-activating chemokine; Kidney-expressed chemokine CXC; MIP-2G; Small-inducible cytokine B14 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-X-C motif chemokine 14 protein (Cxcl14), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9WUQ5; Cxcl14; Bmac; Kec; Ks1; Mip2g; Scyb14

Expression Region

23-99aa

Host

E. coli

Target

C-X-C motif chemokine 14 protein (Cxcl14)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

9.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

B-cell and monocyte-activating chemokine; Kidney-expressed chemokine CXC; MIP-2G; Small-inducible cytokine B14

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIVTTKSMSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLHL22 siRNA (Human)
MBS8207161-01 15 nmol

KLHL22 siRNA (Human)

Sign In for Pricing
View Details
KLHL22 siRNA (Human)
MBS8207161-02 30 nmol

KLHL22 siRNA (Human)

Sign In for Pricing
View Details
KLHL22 siRNA (Human)
MBS8207161-03 5x 30 nmol

KLHL22 siRNA (Human)

Sign In for Pricing
View Details
CRYBG2 (NM_001039775) Human Recombinant Protein
PH36418M5 20 µg

CRYBG2 (NM_001039775) Human Recombinant Protein

Sign In for Pricing
View Details
Bulk Anti-Human CD8 (UCHT-4) Antibody
ICH1005-1mg 1 mg

Bulk Anti-Human CD8 (UCHT-4) Antibody

Sign In for Pricing
View Details
ZNF235 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
51375111 3x 1.0 µg

ZNF235 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details