Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Stromal cell-derived factor 1 protein (Cxcl12), Active Protein

Recombinant Mouse Stromal cell-derived factor 1 protein (Cxcl12), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Stromal cell-derived factor 1 protein (Cxcl12) . Accession Number: P40224; Cxcl12; Sdf1. Expression Region: 22-93aa. Tag Info: Tag-Free. Theoretical MW: 8.5kda. Target Synonyms: SDF-1; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Stromal cell-derived factor 1 protein (Cxcl12), Active Protein is a purified Active Recombinant Protein.

Accession Number

P40224; Cxcl12; Sdf1

Expression Region

22-93aa

Host

E. coli

Target

Stromal cell-derived factor 1 protein (Cxcl12)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.5kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SDF-1; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; PBSF

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

KPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRLKM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C19orf36 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
14063061 1.0 µg DNA

C19orf36 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Anti-CD19 Polyclonal Antibody 5
TMAB-03887-01 50 μL

Anti-CD19 Polyclonal Antibody 5

Sign In for Pricing
View Details
Anti-CD19 Polyclonal Antibody 5
TMAB-03887-02 100 µL

Anti-CD19 Polyclonal Antibody 5

Sign In for Pricing
View Details
Anti-CD19 Polyclonal Antibody 5
TMAB-03887-03 200 µL

Anti-CD19 Polyclonal Antibody 5

Sign In for Pricing
View Details
Rabbit Polyclonal SHANK3 Antibody [Alexa Fluor 700]
NBP2-32161AF700 0.1 mL

Rabbit Polyclonal SHANK3 Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
IRF3 (Phospho-Ser396) Polyclonal Antibody Cy5 Conjugated
MBS9461256-01 0.1 mL

IRF3 (Phospho-Ser396) Polyclonal Antibody Cy5 Conjugated

Sign In for Pricing
View Details