Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C motif chemokine 11 protein (Cxcl11), Active Protein

Recombinant Mouse C-X-C motif chemokine 11 protein (Cxcl11), Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-X-C motif chemokine 11 protein (Cxcl11) . Accession Number: Q9JHH5; Cxcl11; Scyb11. Expression Region: 22-100aa. Tag Info: Tag-Free. Theoretical MW: 9.1kda. Target Synonyms: Interferon-inducible T-cell alpha chemoattractant; Small-inducible cytokine B11 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-X-C motif chemokine 11 protein (Cxcl11), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9JHH5; Cxcl11; Scyb11

Expression Region

22-100aa

Host

E. coli

Target

C-X-C motif chemokine 11 protein (Cxcl11)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

9.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interferon-inducible T-cell alpha chemoattractant; Small-inducible cytokine B11

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody
MBS9437730-01 0.1 mL (Biotin)

NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody
MBS9437730-02 0.1 mL (AF350)

NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody
MBS9437730-03 0.1 mL (AF405)

NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody
MBS9437730-04 0.1 mL (AF488)

NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody
MBS9437730-05 0.1 mL (AF555)

NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody
MBS9437730-06 0.1 mL (AF594)

NUR77 (Phospho-Ser351) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details