Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-X-C motif chemokine 10 protein (Cxcl10), Active Protein

Recombinant Mouse C-X-C motif chemokine 10 protein (Cxcl10), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-X-C motif chemokine 10 protein (Cxcl10) . Accession Number: P17515; Cxcl10; Crg2; Ifi10; Inp10; Scyb10. Expression Region: 22-98aa. Tag Info: Tag-Free. Theoretical MW: 8.7kda. Target Synonyms: 10 kDa interferon gamma-induced protein; IP-10; C7; Interferon-gamma induced protein CRG-2; Small-inducible cytokine B10 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-X-C motif chemokine 10 protein (Cxcl10), Active Protein is a purified Active Recombinant Protein.

Accession Number

P17515; Cxcl10; Crg2; Ifi10; Inp10; Scyb10

Expression Region

22-98aa

Host

E. coli

Target

C-X-C motif chemokine 10 protein (Cxcl10)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

10 kDa interferon gamma-induced protein; IP-10; C7; Interferon-gamma induced protein CRG-2; Small-inducible cytokine B10

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit
MBS4502358-01 48 Tests

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit

Sign In for Pricing
View Details
Human SATB Homeobox Protein 1 (SATB1) ELISA Kit
MBS4502358-02 96 Tests

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit

Sign In for Pricing
View Details
Human SATB Homeobox Protein 1 (SATB1) ELISA Kit
MBS4502358-03 5x 96 Tests

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit

Sign In for Pricing
View Details
Human SATB Homeobox Protein 1 (SATB1) ELISA Kit
MBS4502358-04 10x 96 Tests

Human SATB Homeobox Protein 1 (SATB1) ELISA Kit

Sign In for Pricing
View Details
Topotecan 10mM * 1mL in DMSO
A16815-10mM-D 10 mM x 1mL in DMSO

Topotecan 10mM * 1mL in DMSO

Sign In for Pricing
View Details
KCNAB2 Rabbit Polyclonal Antibody
E28PN6771 100 µL

KCNAB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details