Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 28 protein (Ccl28), partial , Active Protein

Recombinant Mouse C-C motif chemokine 28 protein (Ccl28), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: C-C motif chemokine 28 protein (Ccl28) . Accession Number: Q9JIL2; Ccl28; Scya28. Expression Region: 20-130aa. Tag Info: Tag-Free. Theoretical MW: 12.6kda. Target Synonyms: Small-inducible cytokine A28 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse C-C motif chemokine 28 protein (Ccl28), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9JIL2; Ccl28; Scya28

Expression Region

20-130aa

Host

E. coli

Target

C-C motif chemokine 28 protein (Ccl28)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

12.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Small-inducible cytokine A28

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

SEAILPMASSCCTEVSHHVSGRLLERVSSCSIQRADGDCDLAAVILHVKRRRICISPHNRTLKQWMRASEVKKNGRENVCSGKKQPSRKDRKGHTTRKHRTRGTHRHEASR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD67 (GAD1) Mouse Monoclonal Antibody [Clone ID: OTI3G9]
TA500329 100 µL

GAD67 (GAD1) Mouse Monoclonal Antibody [Clone ID: OTI3G9]

Sign In for Pricing
View Details
Ifngr1 3'UTR GFP Stable Cell Line
TU159936 1.0 mL

Ifngr1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GNPNAT1 (NM_198066) Human Recombinant Protein
TP304268 20 µg

GNPNAT1 (NM_198066) Human Recombinant Protein

Sign In for Pricing
View Details
Spinorphin, bovine
5-01956 4x 5 mg

Spinorphin, bovine

Sign In for Pricing
View Details
ISLR, CT (ISLR, Immunoglobulin superfamily containing leucine-rich repeat protein) (Azide free) (HRP)
MBS6311074-01 0.2 mL

ISLR, CT (ISLR, Immunoglobulin superfamily containing leucine-rich repeat protein) (Azide free) (HRP)

Sign In for Pricing
View Details
ISLR, CT (ISLR, Immunoglobulin superfamily containing leucine-rich repeat protein) (Azide free) (HRP)
MBS6311074-02 5x 0.2 mL

ISLR, CT (ISLR, Immunoglobulin superfamily containing leucine-rich repeat protein) (Azide free) (HRP)

Sign In for Pricing
View Details