Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Growth-regulated alpha protein (Cxcl1), Active Protein

Recombinant Mouse Growth-regulated alpha protein (Cxcl1), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Growth-regulated alpha protein (Cxcl1) . Accession Number: P12850; Cxcl1; Gro; Gro1; Mgsa; Scyb1. Expression Region: 25-96aa. Tag Info: Tag-Free. Theoretical MW: 7.8kda. Target Synonyms: C-X-C motif chemokine 1; Secretory protein N51; ; Hematopoietic synergistic factor; HSF Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Growth-regulated alpha protein (Cxcl1), Active Protein is a purified Active Recombinant Protein.

Accession Number

P12850; Cxcl1; Gro; Gro1; Mgsa; Scyb1

Expression Region

25-96aa

Host

E. coli

Target

Growth-regulated alpha protein (Cxcl1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

C-X-C motif chemokine 1; Secretory protein N51; ; Hematopoietic synergistic factor; HSF

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

APIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Linker for Activation of T-Cell ELISA Kit
MBS746663-01 48 Well

Canine Linker for Activation of T-Cell ELISA Kit

Sign In for Pricing
View Details
Canine Linker for Activation of T-Cell ELISA Kit
MBS746663-02 96 Well

Canine Linker for Activation of T-Cell ELISA Kit

Sign In for Pricing
View Details
Canine Linker for Activation of T-Cell ELISA Kit
MBS746663-03 5x 96 Well

Canine Linker for Activation of T-Cell ELISA Kit

Sign In for Pricing
View Details
Canine Linker for Activation of T-Cell ELISA Kit
MBS746663-04 10x 96 Well

Canine Linker for Activation of T-Cell ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 18 Receptor 1 ELISA Kit
MBS049347-01 48 Well

Rat Interleukin 18 Receptor 1 ELISA Kit

Sign In for Pricing
View Details
Rat Interleukin 18 Receptor 1 ELISA Kit
MBS049347-02 96 Well

Rat Interleukin 18 Receptor 1 ELISA Kit

Sign In for Pricing
View Details