Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 3-like 1 protein (CCL3L1), Active Protein

Recombinant Human C-C motif chemokine 3-like 1 protein (CCL3L1), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-C motif chemokine 3-like 1 protein (CCL3L1) . Accession Number: P16619; CCL3L1; D17S1718; G0S19-2; SCYA3L1; ; CCL3L3. Expression Region: 24-93aa. Tag Info: Tag-Free. Theoretical MW: 7.8kda. Target Synonyms: G0/G1 switch regulatory protein 19-2 PAT 464.2; Small-inducible cytokine A3-like 1; Tonsillar lymphocyte LD78 beta protein Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-C motif chemokine 3-like 1 protein (CCL3L1), Active Protein is a purified Active Recombinant Protein.

Accession Number

P16619; CCL3L1; D17S1718; G0S19-2; SCYA3L1; ; CCL3L3

Expression Region

24-93aa

Host

E. coli

Target

C-C motif chemokine 3-like 1 protein (CCL3L1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

G0/G1 switch regulatory protein 19-2 PAT 464.2; Small-inducible cytokine A3-like 1; Tonsillar lymphocyte LD78 beta protein

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SARS-CoV-2 RBD (Beta-27 Fab)
MBS1564903-01 0.1 mg

Anti-SARS-CoV-2 RBD (Beta-27 Fab)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 RBD (Beta-27 Fab)
MBS1564903-02 1 mg

Anti-SARS-CoV-2 RBD (Beta-27 Fab)

Sign In for Pricing
View Details
Anti-SARS-CoV-2 RBD (Beta-27 Fab)
MBS1564903-03 5x 1 mg

Anti-SARS-CoV-2 RBD (Beta-27 Fab)

Sign In for Pricing
View Details
CHGA, 19-457aa, Human, His-tag, Baculovirus
MBS206778-01 0.01 mg

CHGA, 19-457aa, Human, His-tag, Baculovirus

Sign In for Pricing
View Details
CHGA, 19-457aa, Human, His-tag, Baculovirus
MBS206778-02 0.02 mg

CHGA, 19-457aa, Human, His-tag, Baculovirus

Sign In for Pricing
View Details
CHGA, 19-457aa, Human, His-tag, Baculovirus
MBS206778-03 0.05 mg

CHGA, 19-457aa, Human, His-tag, Baculovirus

Sign In for Pricing
View Details