Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Lymphotactin protein (XCL1), partial , Active Protein

Recombinant Human Lymphotactin protein (XCL1), partial , Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Lymphotactin protein (XCL1) . Accession Number: P47992; XCL1; LTN; SCYC1. Expression Region: 23-114aa. Tag Info: Tag-Free. Theoretical MW: 10.2kda. Target Synonyms: ATAC; Cytokine SCM-1; Lymphotaxin; SCM-1-alpha; Small-inducible cytokine C1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Lymphotactin protein (XCL1), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P47992; XCL1; LTN; SCYC1

Expression Region

23-114aa

Host

E. coli

Target

Lymphotactin protein (XCL1)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ATAC; Cytokine SCM-1; Lymphotaxin; SCM-1-alpha; Small-inducible cytokine C1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CC147 rabbit pAb
RA31441-01 50 µL

CC147 rabbit pAb

Sign In for Pricing
View Details
CC147 rabbit pAb
RA31441-02 100 µL

CC147 rabbit pAb

Sign In for Pricing
View Details
NUBP1, Recombinant, Human, aa1-320, His-Tag (Cytosolic Fe-S Cluster Assembly Factor NuBP1 Isoform 1, Nucleotide-Binding Protein 1)
218408-01 100 µg

NUBP1, Recombinant, Human, aa1-320, His-Tag (Cytosolic Fe-S Cluster Assembly Factor NuBP1 Isoform 1, Nucleotide-Binding Protein 1)

Sign In for Pricing
View Details
NUBP1, Recombinant, Human, aa1-320, His-Tag (Cytosolic Fe-S Cluster Assembly Factor NuBP1 Isoform 1, Nucleotide-Binding Protein 1)
218408-02 500 µg

NUBP1, Recombinant, Human, aa1-320, His-Tag (Cytosolic Fe-S Cluster Assembly Factor NuBP1 Isoform 1, Nucleotide-Binding Protein 1)

Sign In for Pricing
View Details
MAVS CRISPR Knockout Huh-7 Stable Cell Line (MAVS KO Huh7)
T3722 1x106 cells / 1.0 mL

MAVS CRISPR Knockout Huh-7 Stable Cell Line (MAVS KO Huh7)

Sign In for Pricing
View Details
Recombinant Human MOB Kinase Activator 1A/MOB1A (C-6His)
C297-1mg 1 mg

Recombinant Human MOB Kinase Activator 1A/MOB1A (C-6His)

Sign In for Pricing
View Details