Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 13 protein (CXCL13) . Accession Number: O43927; CXCL13; BCA1; BLC; SCYB13. Expression Region: 23-109aa. Tag Info: Tag-Free. Theoretical MW: 10.3kda. Target Synonyms: Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein.

Accession Number

O43927; CXCL13; BCA1; BLC; SCYB13

Expression Region

23-109aa

Host

E. coli

Target

C-X-C motif chemokine 13 protein (CXCL13)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EM 523
MF-0140424-01 25 mg

EM 523

Sign In for Pricing
View Details
EM 523
MF-0140424-02 50 mg

EM 523

Sign In for Pricing
View Details
EM 523
MF-0140424-03 100 mg

EM 523

Sign In for Pricing
View Details
Caprisil C8-IP HPLC Column, 3 µm, 100 Å, CX535-C8-IP x 125 mm
CX335-C8-IP 3 µm

Caprisil C8-IP HPLC Column, 3 µm, 100 Å, CX535-C8-IP x 125 mm

Sign In for Pricing
View Details
Inhibitor hsa-miR-1537 AAV miRNA Vector
Amh3021800 500 ng

Inhibitor hsa-miR-1537 AAV miRNA Vector

Sign In for Pricing
View Details
Vom1r102 ORF Vector (Rat) (pORF)
ORF078819 1.0 µg DNA

Vom1r102 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details