Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 13 protein (CXCL13) . Accession Number: O43927; CXCL13; BCA1; BLC; SCYB13. Expression Region: 23-109aa. Tag Info: Tag-Free. Theoretical MW: 10.3kda. Target Synonyms: Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 13 protein (CXCL13), Active Protein is a purified Active Recombinant Protein.

Accession Number

O43927; CXCL13; BCA1; BLC; SCYB13

Expression Region

23-109aa

Host

E. coli

Target

C-X-C motif chemokine 13 protein (CXCL13)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.3kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Angie; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)
MBS2167150-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)
MBS2167150-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)
MBS2167150-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)
MBS2167150-04 1 mL

Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)
MBS2167150-05 5 mL

Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)
MBS2167150-06 5x 5 mL

Biotin-Linked Polyclonal Antibody to Cytokeratin 18 (CK18)

Sign In for Pricing
View Details