Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein is a purified Active Recombinant Protein. Purity: >96% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Stromal cell-derived factor 1 protein (CXCL12) . Accession Number: P48061; CXCL12; SDF1; SDF1A; SDF1B. Expression Region: 21-119aa. Tag Info: Tag-Free. Theoretical MW: 11.6kda. Target Synonyms: SDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P48061; CXCL12; SDF1; SDF1A; SDF1B

Expression Region

21-119aa

Host

E. coli

Target

Stromal cell-derived factor 1 protein (CXCL12)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>96% by SDS-PAGE

Activity

Biologically Active

Length

Partial of Isoform Gamma

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

11.6kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

GKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKGRREEKVGKKEKIGKKKRQKKRKAAQKRKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABRG2, ID (GABRG2, Gamma-aminobutyric acid receptor subunit gamma-2, GABA(A) receptor subunit gamma-2) (Azide free) (HRP)
MBS6300899-01 0.2 mL

GABRG2, ID (GABRG2, Gamma-aminobutyric acid receptor subunit gamma-2, GABA(A) receptor subunit gamma-2) (Azide free) (HRP)

Sign In for Pricing
View Details
GABRG2, ID (GABRG2, Gamma-aminobutyric acid receptor subunit gamma-2, GABA(A) receptor subunit gamma-2) (Azide free) (HRP)
MBS6300899-02 5x 0.2 mL

GABRG2, ID (GABRG2, Gamma-aminobutyric acid receptor subunit gamma-2, GABA(A) receptor subunit gamma-2) (Azide free) (HRP)

Sign In for Pricing
View Details
Lymphotactin (XCL1, LTN, ATAC, LPTN, SCM1, SCM-1, SCM1A, SCYC1, SCM-1a) (MaxLight 405)
MBS6447597-01 0.1 mL

Lymphotactin (XCL1, LTN, ATAC, LPTN, SCM1, SCM-1, SCM1A, SCYC1, SCM-1a) (MaxLight 405)

Sign In for Pricing
View Details
Lymphotactin (XCL1, LTN, ATAC, LPTN, SCM1, SCM-1, SCM1A, SCYC1, SCM-1a) (MaxLight 405)
MBS6447597-02 5x 0.1 mL

Lymphotactin (XCL1, LTN, ATAC, LPTN, SCM1, SCM-1, SCM1A, SCYC1, SCM-1a) (MaxLight 405)

Sign In for Pricing
View Details
1-tert-Butyl 4-ethyl 4- (pyridin-4-yl) piperidine-1,4-dicarboxylate
OR1053000-01 50 mg

1-tert-Butyl 4-ethyl 4- (pyridin-4-yl) piperidine-1,4-dicarboxylate

Sign In for Pricing
View Details
1-tert-Butyl 4-ethyl 4- (pyridin-4-yl) piperidine-1,4-dicarboxylate
OR1053000-02 100 mg

1-tert-Butyl 4-ethyl 4- (pyridin-4-yl) piperidine-1,4-dicarboxylate

Sign In for Pricing
View Details