Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Stromal cell-derived factor 1 protein (CXCL12) . Accession Number: P48061; CXCL12; SDF1; SDF1A; SDF1B. Expression Region: 22-89aa. Tag Info: Tag-Free. Theoretical MW: 8.0kda. Target Synonyms: SDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P48061; CXCL12; SDF1; SDF1A; SDF1B

Expression Region

22-89aa

Host

E. coli

Target

Stromal cell-derived factor 1 protein (CXCL12)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCH2 (E3 Ubiquitin-protein Ligase MARCH2, Membrane-associated RING Finger Protein 2, Membrane-associated RING-CH Protein II, MARCH-II, RING Finger Protein 172, RNF172, HSPC240) (Biotin)
129428-Biotin 100 µL

MARCH2 (E3 Ubiquitin-protein Ligase MARCH2, Membrane-associated RING Finger Protein 2, Membrane-associated RING-CH Protein II, MARCH-II, RING Finger Protein 172, RNF172, HSPC240) (Biotin)

Sign In for Pricing
View Details
CLDN7 Protein Lysate (Rat) with C-HA Tag
16287036 100 µg

CLDN7 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
MAGEA5 ORF Vector (Human) (pORF)
27918011 1.0 µg DNA

MAGEA5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
PHF5EP AAV Vector (Human) (CMV)
36577101 1 µg

PHF5EP AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
TREX2 (NM_080701) Human Over-expression Lysate
LH13483V 100 µg

TREX2 (NM_080701) Human Over-expression Lysate

Sign In for Pricing
View Details
Olr309 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7310208 1.0 µg DNA

Olr309 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details