Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Stromal cell-derived factor 1 protein (CXCL12) . Accession Number: P48061; CXCL12; SDF1; SDF1A; SDF1B. Expression Region: 22-89aa. Tag Info: Tag-Free. Theoretical MW: 8.0kda. Target Synonyms: SDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Stromal cell-derived factor 1 protein (CXCL12), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P48061; CXCL12; SDF1; SDF1A; SDF1B

Expression Region

22-89aa

Host

E. coli

Target

Stromal cell-derived factor 1 protein (CXCL12)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

SDF-1; C-X-C motif chemokine 12; Intercrine reduced in hepatomas; IRH; hIRH

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta I Tubulin Monoclonal Antibody, APC-Cy7 Conjugated
bsm-33041M-APC-Cy7 100 µL

Beta I Tubulin Monoclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
PLA2G4B Protein Vector (Mouse) (pPM-C-His)
PV216717 500 ng

PLA2G4B Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
TTLL8 HDR Plasmid (m)
sc-433698-HDR 20 µg

TTLL8 HDR Plasmid (m)

Sign In for Pricing
View Details
MFluor™ Violet 540 Anti-human CD340 Antibody *24D2*
13400120-AAT 100 Tests

MFluor™ Violet 540 Anti-human CD340 Antibody *24D2*

Sign In for Pricing
View Details
Minocyclin HSA Biotin Conjugate
B2021613 1 mg

Minocyclin HSA Biotin Conjugate

Sign In for Pricing
View Details
Porcine F box only protein 25 (FBXO25) ELISA Kit
GTR10350603 96 Well

Porcine F box only protein 25 (FBXO25) ELISA Kit

Sign In for Pricing
View Details