Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 5 protein (CXCL5) . Accession Number: P42830; CXCL5; ENA78; SCYB5. Expression Region: 41-114aa. Tag Info: Tag-Free. Theoretical MW: 8.1kda. Target Synonyms: ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P42830; CXCL5; ENA78; SCYB5

Expression Region

41-114aa

Host

E. coli

Target

C-X-C motif chemokine 5 protein (CXCL5)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Karyopherin 13 (D-3) Alexa Fluor® 488
sc-271218 AF488 200 µg/mL

Karyopherin 13 (D-3) Alexa Fluor® 488

Sign In for Pricing
View Details
Bridge-It L-Tryptophan 100
1-1-1002A 1 Kit

Bridge-It L-Tryptophan 100

Sign In for Pricing
View Details
FCER1G Antibody, HRP conjugated
A21743-100UG 100 µg

FCER1G Antibody, HRP conjugated

Sign In for Pricing
View Details
FlaPure Plant Total RNA Extraction Kit (Centrifugal Column Type)
RE714 50 Reactions

FlaPure Plant Total RNA Extraction Kit (Centrifugal Column Type)

Sign In for Pricing
View Details
Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit
MBS459406-01 48 Tests

Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit

Sign In for Pricing
View Details
Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit
MBS459406-02 96 Tests

Mouse Follistatin Like Protein 3 (FSTL3) ELISA Kit

Sign In for Pricing
View Details