Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 5 protein (CXCL5) . Accession Number: P42830; CXCL5; ENA78; SCYB5. Expression Region: 41-114aa. Tag Info: Tag-Free. Theoretical MW: 8.1kda. Target Synonyms: ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P42830; CXCL5; ENA78; SCYB5

Expression Region

41-114aa

Host

E. coli

Target

C-X-C motif chemokine 5 protein (CXCL5)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goal anti-Cat IgA Heavy Chain Antibody Affinity Purified
A20-101A 1 mg

Goal anti-Cat IgA Heavy Chain Antibody Affinity Purified

Sign In for Pricing
View Details
Human IP10 ELISA Kit
E020291 1 Each

Human IP10 ELISA Kit

Sign In for Pricing
View Details
Carbon dioxide reduction factor
MF-0006905 25 mg

Carbon dioxide reduction factor

Sign In for Pricing
View Details
YIF1A AAV siRNA Pooled Vector
50609161 1.0 µg

YIF1A AAV siRNA Pooled Vector

Sign In for Pricing
View Details
SERPINB13 (Serine Protease Inhibitor B13, SERPINB 13, SERPINB-13) (AP)
MBS6453566-01 0.1 mL

SERPINB13 (Serine Protease Inhibitor B13, SERPINB 13, SERPINB-13) (AP)

Sign In for Pricing
View Details
SERPINB13 (Serine Protease Inhibitor B13, SERPINB 13, SERPINB-13) (AP)
MBS6453566-02 5x 0.1 mL

SERPINB13 (Serine Protease Inhibitor B13, SERPINB 13, SERPINB-13) (AP)

Sign In for Pricing
View Details