Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 5 protein (CXCL5) . Accession Number: P42830; CXCL5; ENA78; SCYB5. Expression Region: 41-114aa. Tag Info: Tag-Free. Theoretical MW: 8.1kda. Target Synonyms: ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P42830; CXCL5; ENA78; SCYB5

Expression Region

41-114aa

Host

E. coli

Target

C-X-C motif chemokine 5 protein (CXCL5)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PLCD3 Knockout A549 cell line
GTR15406980 1 Vial

Human PLCD3 Knockout A549 cell line

Sign In for Pricing
View Details
OLFM3 Antibody
A30314-100UL 100 µL

OLFM3 Antibody

Sign In for Pricing
View Details
SHFM1 (SEM1) (NM_006304) Human Tagged ORF Clone Lentiviral Particle
RC207564L2V 200 µL

SHFM1 (SEM1) (NM_006304) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Herc4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6673606 1.0 µg DNA

Herc4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Agarose Immobilized IgG Fraction of anti-Human IgG [H&L] [Goat]
SR005 5 mg

Agarose Immobilized IgG Fraction of anti-Human IgG [H&L] [Goat]

Sign In for Pricing
View Details
RPL39P9 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV781209 1.0 µg DNA

RPL39P9 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details