Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 5 protein (CXCL5) . Accession Number: P42830; CXCL5; ENA78; SCYB5. Expression Region: 41-114aa. Tag Info: Tag-Free. Theoretical MW: 8.1kda. Target Synonyms: ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P42830; CXCL5; ENA78; SCYB5

Expression Region

41-114aa

Host

E. coli

Target

C-X-C motif chemokine 5 protein (CXCL5)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MAP2K4 Recombinant Protein
PPT-13778 100 µg

Human MAP2K4 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal UCH-L1/PGP9.5 Antibody (UCHL1/775) [DyLight 755]
NBP2-47932IR 0.1 mL

Mouse Monoclonal UCH-L1/PGP9.5 Antibody (UCHL1/775) [DyLight 755]

Sign In for Pricing
View Details
Human IRF7 Knockout HEK293T cell line
GTR15411969 1 Vial

Human IRF7 Knockout HEK293T cell line

Sign In for Pricing
View Details
Mouse Surfactant Associated Protein B (SPB) ELISA Kit
RD-SPB-Mu-01 96 Tests

Mouse Surfactant Associated Protein B (SPB) ELISA Kit

Sign In for Pricing
View Details
Mouse Surfactant Associated Protein B (SPB) ELISA Kit
RD-SPB-Mu-02 48 Tests

Mouse Surfactant Associated Protein B (SPB) ELISA Kit

Sign In for Pricing
View Details
RPS26P46 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV784527 1.0 µg DNA

RPS26P46 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details