Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-X-C motif chemokine 5 protein (CXCL5) . Accession Number: P42830; CXCL5; ENA78; SCYB5. Expression Region: 41-114aa. Tag Info: Tag-Free. Theoretical MW: 8.1kda. Target Synonyms: ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-X-C motif chemokine 5 protein (CXCL5), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

P42830; CXCL5; ENA78; SCYB5

Expression Region

41-114aa

Host

E. coli

Target

C-X-C motif chemokine 5 protein (CXCL5)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

8.1kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

ENA-78; Epithelial-derived neutrophil-activating protein 78; Neutrophil-activating peptide ENA-78; Small-inducible cytokine B5

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Macrophage-Derived Chemokine CLIA Kit
MBS8426380-01 1 Kit

Mouse Macrophage-Derived Chemokine CLIA Kit

Sign In for Pricing
View Details
Mouse Macrophage-Derived Chemokine CLIA Kit
MBS8426380-02 5x 1 Kit

Mouse Macrophage-Derived Chemokine CLIA Kit

Sign In for Pricing
View Details
ORP4/OSBP2 Polyclonal Antibody, RBITC Conjugated
bs-6560R-RBITC 100 µL

ORP4/OSBP2 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Recombinant Cynomolgus Monkey PPT1 Protein, His (Fc)-Avi-tagged
PPT1-551C 50 µg

Recombinant Cynomolgus Monkey PPT1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rabbit Anti-TMEM132A antibody
SL12068R-01 50 µL

Rabbit Anti-TMEM132A antibody

Sign In for Pricing
View Details
Rabbit Anti-TMEM132A antibody
SL12068R-02 100 µL

Rabbit Anti-TMEM132A antibody

Sign In for Pricing
View Details