Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 15 protein (CCL15), Active Protein

Recombinant Human C-C motif chemokine 15 protein (CCL15), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-C motif chemokine 15 protein (CCL15) . Accession Number: Q16663; CCL15; MIP5; NCC3; SCYA15. Expression Region: 22-113aa. Tag Info: Tag-Free. Theoretical MW: 10.2kda. Target Synonyms: Chemokine CC-2; Leukotactin-1; LKN-1; MIP-1 delta; Macrophage inflammatory protein 5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-C motif chemokine 15 protein (CCL15), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q16663; CCL15; MIP5; NCC3; SCYA15

Expression Region

22-113aa

Host

E. coli

Target

C-C motif chemokine 15 protein (CCL15)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

10.2kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Chemokine CC-2; Leukotactin-1; LKN-1; MIP-1 delta; Macrophage inflammatory protein 5

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

VPS25 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
50175124 3x 1.0µg DNA

VPS25 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
CNOT6L ORF Vector (Human) (pORF)
ORF017543 1.0 µg DNA

CNOT6L ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
KV3.1 discontinued
390986 200 µL

KV3.1 discontinued

Sign In for Pricing
View Details
MCF2 (NM_001171876) Human Tagged ORF Clone
RG230610 10 µg

MCF2 (NM_001171876) Human Tagged ORF Clone

Sign In for Pricing
View Details
Donson Rat shRNA Lentiviral Particle (Locus ID 288257)
TL700961V 500 µL Each

Donson Rat shRNA Lentiviral Particle (Locus ID 288257)

Sign In for Pricing
View Details
Rat Semaphorin-6B ELISA Kit
MBS2883396-01 48 Well

Rat Semaphorin-6B ELISA Kit

Sign In for Pricing
View Details