Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C motif chemokine 15 protein (CCL15), partial , Active Protein

Recombinant Human C-C motif chemokine 15 protein (CCL15), partial , Active Protein is a purified Active Recombinant Protein. Purity: >98% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: C-C motif chemokine 15 protein (CCL15) . Accession Number: Q16663; CCL15; MIP5; NCC3; SCYA15. Expression Region: 46-113aa. Tag Info: Tag-Free. Theoretical MW: 7.4kda. Target Synonyms: Chemokine CC-2; Leukotactin-1; LKN-1; MIP-1 delta; Macrophage inflammatory protein 5 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human C-C motif chemokine 15 protein (CCL15), partial , Active Protein is a purified Active Recombinant Protein.

Accession Number

Q16663; CCL15; MIP5; NCC3; SCYA15

Expression Region

46-113aa

Host

E. coli

Target

C-C motif chemokine 15 protein (CCL15)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>98% by SDS-PAGE

Activity

Biologically Active

Length

Partial

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

7.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Chemokine CC-2; Leukotactin-1; LKN-1; MIP-1 delta; Macrophage inflammatory protein 5

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1ql2 (NM_207233) Mouse Tagged Lenti ORF Clone
MR222953L3 10 µg

C1ql2 (NM_207233) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
ADAMTS19 (NM_133638) Human Tagged ORF Clone Lentiviral Particle
RC213075L3V 200 µL

ADAMTS19 (NM_133638) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Sheep Schistosoma (STS) ELISA Kit
OM619591 96 Strip Well

Sheep Schistosoma (STS) ELISA Kit

Sign In for Pricing
View Details
Cask Rat shRNA Plasmid (Locus ID 29647)
TL710565 1 Kit

Cask Rat shRNA Plasmid (Locus ID 29647)

Sign In for Pricing
View Details
CD56 (NCAM-1, Neural Cell Adhesion Molecule) (HRP)
MBS6250657-01 0.1 mL

CD56 (NCAM-1, Neural Cell Adhesion Molecule) (HRP)

Sign In for Pricing
View Details
CD56 (NCAM-1, Neural Cell Adhesion Molecule) (HRP)
MBS6250657-02 5x 0.1 mL

CD56 (NCAM-1, Neural Cell Adhesion Molecule) (HRP)

Sign In for Pricing
View Details