Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 alpha protein (Il1a), Active Protein

Recombinant Mouse Interleukin-1 alpha protein (Il1a), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-1 alpha protein (Il1a) . Accession Number: P01582; Il1a. Expression Region: 115-270aa. Tag Info: Tag-Free. Theoretical MW: 17.9kda. Target Synonyms: IL-1 alpha Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-1 alpha protein (Il1a), Active Protein is a purified Active Recombinant Protein.

Accession Number

P01582; Il1a

Expression Region

115-270aa

Host

E. coli

Target

Interleukin-1 alpha protein (Il1a)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.9kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-1 alpha

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

SAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)
MBS1327470-01 0.05 mg (E-Coli)

Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)

Sign In for Pricing
View Details
Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)
MBS1327470-02 0.05 mg (Yeast)

Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)

Sign In for Pricing
View Details
Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)
MBS1327470-03 0.2 mg (E-Coli)

Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)

Sign In for Pricing
View Details
Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)
MBS1327470-04 0.5 mg (E-Coli)

Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)

Sign In for Pricing
View Details
Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)
MBS1327470-05 0.05 mg (Baculovirus)

Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)

Sign In for Pricing
View Details
Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)
MBS1327470-06 0.2 mg (Yeast)

Recombinant Candida glabrata SWR1-complex protein 7 (SWC7)

Sign In for Pricing
View Details