Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-36 beta protein (Il36b), Active Protein

Recombinant Mouse Interleukin-36 beta protein (Il36b), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-36 beta protein (Il36b) . Accession Number: Q9D6Z6; Il36b; Fil1e; Il1f8. Expression Region: 31-183aa. Tag Info: Tag-Free. Theoretical MW: 17.4kda. Target Synonyms: Interleukin-1 family member 8 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-36 beta protein (Il36b), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9D6Z6; Il36b; Fil1e; Il1f8

Expression Region

31-183aa

Host

E. coli

Target

Interleukin-36 beta protein (Il36b)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-1 family member 8

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alyref2 Mouse Gene Knockout Kit (CRISPR)
KN501177 1 Kit

Alyref2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR2T2 Human Gene Knockout Kit (CRISPR)
KN422791 1 Kit

OR2T2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG1), CF568 conjugate, 0.1mg/mL
BNC681686-500 1x 500 µL

VEGF (Vascular Endothelial Growth Factor) (VG1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CHREBP (mLXIPL) activation kit by CRISPRa
GA109550 1 Kit

Human CHREBP (mLXIPL) activation kit by CRISPRa

Sign In for Pricing
View Details
ZNF124 Rabbit Polyclonal Antibody
TA383513 100 µL

ZNF124 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MUSK pTyr755 Rabbit Polyclonal Antibody
AP26453PU-S 50 µL

MUSK pTyr755 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details