Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-36 beta protein (Il36b), Active Protein

Recombinant Mouse Interleukin-36 beta protein (Il36b), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Mouse (Mus musculus) . Target Name: Interleukin-36 beta protein (Il36b) . Accession Number: Q9D6Z6; Il36b; Fil1e; Il1f8. Expression Region: 31-183aa. Tag Info: Tag-Free. Theoretical MW: 17.4kda. Target Synonyms: Interleukin-1 family member 8 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Mouse Interleukin-36 beta protein (Il36b), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9D6Z6; Il36b; Fil1e; Il1f8

Expression Region

31-183aa

Host

E. coli

Target

Interleukin-36 beta protein (Il36b)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.4kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

Interleukin-1 family member 8

Species

Mouse (Mus musculus)

Protein Name

Active Recombinant Protein

AA Sequence

SSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRITC Conjugated Goat Polyclonal Antibody to Human Prealbumin
RA-2112-2 2 mL

TRITC Conjugated Goat Polyclonal Antibody to Human Prealbumin

Sign In for Pricing
View Details
Recombinant Human GLIPR1 Protein (His Tag)
PKSH033396-01 10 µg

Recombinant Human GLIPR1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human GLIPR1 Protein (His Tag)
PKSH033396-02 50 µg

Recombinant Human GLIPR1 Protein (His Tag)

Sign In for Pricing
View Details
CD5 (C5/473 + CD5/54/F6), CF647 conjugate, 0.1mg/mL
BNC470748-100 1x 100 µL

CD5 (C5/473 + CD5/54/F6), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAM55C (NXPE3) (NM_145037) Human Over-expression Lysate
LY403417 100 µg

FAM55C (NXPE3) (NM_145037) Human Over-expression Lysate

Sign In for Pricing
View Details
Arachidonoyl Chloride
TRC-A765155-500MG 500 mg

Arachidonoyl Chloride

Sign In for Pricing
View Details