Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN), Active Protein

Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-36 receptor antagonist protein (IL36RN) . Accession Number: Q9UBH0; IL36RN; FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3; UNQ1896/PRO4342. Expression Region: 2-155aa. Tag Info: Tag-Free. Theoretical MW: 16.8kda. Target Synonyms: IL-36Ra; IL-1-related protein 3; IL-1RP3; Interleukin-1 HY1; IL-1HY1 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-36 receptor antagonist protein (IL36RN), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9UBH0; IL36RN; FIL1D; IL1F5; IL1HY1; IL1L1; IL1RP3; UNQ1896/PRO4342

Expression Region

2-155aa

Host

E. coli

Target

Interleukin-36 receptor antagonist protein (IL36RN)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

16.8kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-36Ra; IL-1-related protein 3; IL-1RP3; Interleukin-1 HY1; IL-1HY1

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL
BNC680146-500 1x 500 µL

CD10 (CB-CALLA), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL
BNC400218-500 1x 500 µL

CD100 (Semaphorin-4D) (A8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Vimentin (VM452), CF740 conjugate, 0.1mg/mL
BNC740452-500 1x 500 µL

Vimentin (VM452), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-100 1x 100 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (Ki-1/779), CF594 conjugate, 0.1mg/mL
BNC940779-500 1x 500 µL

CD30 (Ki-1/779), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details