Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-36 gamma protein (IL36G), Active Protein

Recombinant Human Interleukin-36 gamma protein (IL36G), Active Protein is a purified Active Recombinant Protein. Purity: >95% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-36 gamma protein (IL36G) . Accession Number: Q9NZH8; IL36G; IL1E; IL1F9; IL1H1; IL1RP2; UNQ2456/PRO5737. Expression Region: 18-169aa. Tag Info: Tag-Free. Theoretical MW: 17.0kda. Target Synonyms: IL-1-related protein 2; Interleukin-1 epsilon; IL-1 epsilon; Interleukin-1 family member 9; IL-1F9 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-36 gamma protein (IL36G), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9NZH8; IL36G; IL1E; IL1F9; IL1H1; IL1RP2; UNQ2456/PRO5737

Expression Region

18-169aa

Host

E. coli

Target

Interleukin-36 gamma protein (IL36G)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>95% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Mature Protein

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.0kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

IL-1-related protein 2; Interleukin-1 epsilon; IL-1 epsilon; Interleukin-1 family member 9; IL-1F9

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-500 1x 500 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-100 1x 100 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL
BNC550146-500 1x 500 µL

CD10 (CB-CALLA), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
BNC740040-500 1x 500 µL

CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (rIGA/764), CF740 conjugate, 0.1mg/mL
BNC741862-100 1x 100 µL

CD79a (B-Cell Marker) (rIGA/764), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details