Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-36 beta protein (IL36B), Active Protein

Recombinant Human Interleukin-36 beta protein (IL36B), Active Protein is a purified Active Recombinant Protein. Purity: >97% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens) . Target Name: Interleukin-36 beta protein (IL36B) . Accession Number: Q9NZH7; IL36B; IL1F8; IL1H2. Expression Region: 1-157aa. Tag Info: Tag-Free. Theoretical MW: 17.7kda. Target Synonyms: FIL1 eta; IL-1 eta; Interleukin-1 family member 8; IL-1F8; Interleukin-1 homolog 2 Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Specifications

Short Description

Recombinant Human Interleukin-36 beta protein (IL36B), Active Protein is a purified Active Recombinant Protein.

Accession Number

Q9NZH7; IL36B; IL1F8; IL1H2

Expression Region

1-157aa

Host

E. coli

Target

Interleukin-36 beta protein (IL36B)

Conjugation

Unconjugated

Tag

Tag-Free

Field of Research

Immunology

Endotoxin

<1.0 EU/ug, by LAL method

Purity

>97% by SDS-PAGE

Activity

Biologically Active

Length

Full Length of Isoform 2

Reconstitution

Refer to the datasheet/CoA included in the product pouch.

Molecular Weight

17.7kDa

Shipping Conditions

Ice packs

Storage Conditions

-20°C. Avoid repeated freeze/thaw cycles.

Target Alternative Name

FIL1 eta; IL-1 eta; Interleukin-1 family member 8; IL-1F8; Interleukin-1 homolog 2

Species

Human (Homo sapiens)

Protein Name

Active Recombinant Protein

AA Sequence

MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COX11 Human Gene Knockout Kit (CRISPR)
KN203238RB 1 Kit

COX11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ki67 Recombinant Rabbit Monoclonal Antibody [PSH0-02]
HA721254 100 µL

Ki67 Recombinant Rabbit Monoclonal Antibody [PSH0-02]

Sign In for Pricing
View Details
Sodium 1H,1H,2H,2H-Perfluorohexane Sulfonate
TRC-S673200-50MG 50 mg

Sodium 1H,1H,2H,2H-Perfluorohexane Sulfonate

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS508066 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
L-Glutamic Acid Monoammonium Salt
TRC-G597140-1G 1 g

L-Glutamic Acid Monoammonium Salt

Sign In for Pricing
View Details
Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF405S conjugate, 0.1mg/mL
BNC042878-500 1x 500 µL

Ornithine Decarboxylase-1 (ODC-1) (ODC1/2878R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details